SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37307_P050
Price: $0.00
SKU
ARP37307_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Jarid2 (ARP37307_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse Jarid2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Guinea Pig: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK
Concentration0.5 mg/ml
Blocking PeptideFor anti-Jarid2 (ARP37307_P050) antibody is Catalog # AAP37307 (Previous Catalog # AAPP09512)
Gene SymbolJarid2
Gene Full NameJumonji, AT rich interactive domain 2
Alias SymbolsJmj, jumo, jumonji
NCBI Gene Id16468
Protein NameProtein Jumonji
Description of TargetJarid2 is a regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis.Jarid2 acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes.Jarid2 binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells.Jarid2 does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases.Jarid2 also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5.Jarid2 participates in the negative regulation of cell proliferation signaling.
Uniprot IDQ62315
Protein Accession #NP_068678
Nucleotide Accession #NM_021878
Protein Size (# AA)1234
Molecular Weight137kDa
Protein InteractionsRb1; Suz12; Ewsr1; Ell; Eed; Aebp2; Morc3; Setx; Stk38l; Thrap3; Ice1; Stk38; Bclaf1; Trim35; Rbbp4; Mtf2; Ezh2; Ezh1;
  1. What is the species homology for "Jarid2 Antibody - middle region (ARP37307_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "Jarid2 Antibody - middle region (ARP37307_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Jarid2 Antibody - middle region (ARP37307_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Jarid2 Antibody - middle region (ARP37307_P050)"?

    This target may also be called "Jmj, jumo, jumonji" in publications.

  5. What is the shipping cost for "Jarid2 Antibody - middle region (ARP37307_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Jarid2 Antibody - middle region (ARP37307_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Jarid2 Antibody - middle region (ARP37307_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "137kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Jarid2 Antibody - middle region (ARP37307_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "JARID2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "JARID2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "JARID2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "JARID2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "JARID2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "JARID2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Jarid2 Antibody - middle region (ARP37307_P050)
Your Rating
We found other products you might like!