IL2RB Recombinant Protein (Mouse) (OPCA04098)

Catalog No: OPCA04098

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Mus musculus (Mouse)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
• Protein Sequence: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 27-240 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Murine interleukin 2 receptor beta chain dysregulated gene expression in lymphoma line EL-4 caused by a promoter insertion.Kono T., Doi T., Yamada G., Hatakeyama M., Minamoto S., Tsudo M., Miyasaka M., Miyata T., Taniguchi T.Proc. Natl. Acad. Sci. U.S.A. 87:1806-1810(1990)

Target Info

• Gene Symbol: Il2rb
• Gene Full Name: interleukin 2 receptor, beta chain
• Alias Symbols: CD122;high affinity IL-2 receptor subunit beta;IL-15 receptor beta chain;IL15R;IL-15R;IL15Rbeta;IL-15Rbeta;IL-2 receptor beta chain;IL-2 receptor subunit beta;IL-2/15 receptor-beta;Il-2/15Rbeta;Il-2R;IL-2R subunit beta;IL-2RB;Il-2Rbeta;interleukin-2 receptor subunit beta;p70;p70-75.
• NCBI Gene Id: 16185
• Protein Name: Interleukin-2 receptor subunit beta
• Description of Target: Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
• Uniprot ID: P16297
• Protein Accession #: NP_032394
• Nucleotide Accession #: NM_008368
• Protein Size (# AA): Recombinant
• Molecular Weight: 27.1 kDa