IGF2BP3 Antibody - middle region (ARP90710_P050)

Catalog No: ARP90710_P050

Host: Rabbit
Target Name: IGF2BP3
Sample Tissue: Mouse Brain lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse IGF2BP3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LIPGLNLNALGLFPPTSGMPPPTSGPPSTLTPPYPQFEQSETETVHLFIP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IGF2BP3 (ARP90710_P050) antibody is Catalog # AAP90710

Target Info

• Gene Symbol: IGF2BP3
• Gene Full Name: insulin-like growth factor 2 mRNA binding protein 3
• Alias Symbols: IM, IMP3, Koc1, IMP-3, Koc13, mimp3, Neilsen, AA522010, AL022933, AU045931, 2610101N11Rik
• NCBI Gene Id: 140488
• Protein Name: insulin-like growth factor 2 mRNA-binding protein 3
• Description of Target: RNA-binding factor that may recruit target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. Binds to the 3'-UTR of CD44 mRNA and stabilizes it, hence promotes cell adhesion and invadopodia formation (By similarity). Binds to beta-actin/ACTB and MYC transcripts (By similarity). Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs.
• Uniprot ID: Q9CPN8
• Protein Accession #: NP_076159.3
• Nucleotide Accession #: NM_023670.3
• Protein Size (# AA): 579
• Molecular Weight: 64 kDa