- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
HS747E2A Antibody - middle region (ARP34804_T100)
| Datasheets/Manuals | Printable datasheet for anti-C22orf31 (ARP34804_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Cow, Dog, Horse, Pig |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HS747E2A |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLED |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-C22orf31 (ARP34804_T100) antibody is Catalog # AAP34804 (Previous Catalog # AAPP06012) |
| Reference | Collins,J.E., et al., (2004) Genome Biol. 5(10), R84 |
| Gene Symbol | C22orf31 |
|---|---|
| Gene Full Name | Chromosome 22 open reading frame 31 |
| Alias Symbols | HS747E2A, bK747E2.1 |
| NCBI Gene Id | 25770 |
| Protein Name | Uncharacterized protein C22orf31 |
| Description of Target | The gene encoding the hypothetical protein HS747E2A is located on chromosome 22. |
| Uniprot ID | O95567 |
| Protein Accession # | NP_056185 |
| Nucleotide Accession # | NM_015370 |
| Protein Size (# AA) | 290 |
| Molecular Weight | 33kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HS747E2A Antibody - middle region (ARP34804_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Horse, Pig".
-
How long will it take to receive "HS747E2A Antibody - middle region (ARP34804_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "HS747E2A Antibody - middle region (ARP34804_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HS747E2A Antibody - middle region (ARP34804_T100)"?
This target may also be called "HS747E2A, bK747E2.1" in publications.
-
What is the shipping cost for "HS747E2A Antibody - middle region (ARP34804_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HS747E2A Antibody - middle region (ARP34804_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HS747E2A Antibody - middle region (ARP34804_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "33kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HS747E2A Antibody - middle region (ARP34804_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "C22ORF31"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "C22ORF31"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "C22ORF31"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "C22ORF31"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "C22ORF31"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "C22ORF31"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.