HS3ST1 Antibody - middle region (ARP33092_P050)

Catalog No: ARP33092_P050

WB Suggested Anti-HS3ST1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Stomach

Host: Rabbit
Target: HS3ST1
Positive control (+): Human stomach (ST)
Negative control (-): Human liver (LI)
Antibody concentration: 3ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HS3ST1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HS3ST1 (ARP33092_P050) antibody is Catalog # AAP33092 (Previous Catalog # AAPP04125)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Edavettal,S.C., (2004) Biochemistry 43 (16), 4680-4688

Target Info

• Gene Symbol: HS3ST1
• Gene Full Name: Heparan sulfate (glucosamine) 3-O-sulfotransferase 1
• Alias Symbols: 3OST, 3OST1
• NCBI Gene Id: 9957
• Protein Name: Heparan sulfate glucosamine 3-O-sulfotransferase 1
• Description of Target: HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein.
• Uniprot ID: O14792
• Protein Accession #: NP_005105
• Nucleotide Accession #: NM_005114
• Protein Size (# AA): 307
• Molecular Weight: 36 kDa
• Protein Interactions: LGR4; APP; UBC;