SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP60766_P050
Price: $0.00
SKU
ARP60766_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HPSE (ARP60766_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HPSE
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 92%; Rabbit: 79%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL
Concentration0.5 mg/ml
Blocking PeptideFor anti-HPSE (ARP60766_P050) antibody is Catalog # AAP60766 (Previous Catalog # AAPP46957)
Publications

High glucose facilitated endothelial heparanase transfer to the cardiomyocyte modifies its cell death signature. Cardiovasc Res. 112, 656-668 (2016). 27979811

The exostosin family of glycosyltransferases: mRNA expression profiles and heparan sulphate structure in human breast carcinoma cell lines. Biosci Rep. 38, (2018). 30054430

Description
Gene SymbolHPSE
Gene Full NameHeparanase
Alias SymbolsHPA, HPA1, HPR1, HSE1, HPSE1
NCBI Gene Id10855
Protein NameHeparanase
Description of TargetHeparan sulfate proteoglycans (HSPGs) are major components of the basement membrane and extracellular matrix. Heparanases, like HSPE, are endoglycosidases that cleave the heparan sulfate side chain of HSPGs to permit the remodeling of the extracellular matrix for cell movement or the release of bioactive molecules from the extracellular matrix or cell surface.
Uniprot IDQ9Y251
Protein Accession #NP_006656
Nucleotide Accession #NM_006665
Protein Size (# AA)543
Molecular Weight61kDa
Protein InteractionsHPSE;
  1. What is the species homology for "HPSE Antibody - N-terminal region (ARP60766_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "HPSE Antibody - N-terminal region (ARP60766_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HPSE Antibody - N-terminal region (ARP60766_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HPSE Antibody - N-terminal region (ARP60766_P050)"?

    This target may also be called "HPA, HPA1, HPR1, HSE1, HPSE1" in publications.

  5. What is the shipping cost for "HPSE Antibody - N-terminal region (ARP60766_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HPSE Antibody - N-terminal region (ARP60766_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HPSE Antibody - N-terminal region (ARP60766_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HPSE Antibody - N-terminal region (ARP60766_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HPSE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HPSE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HPSE"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HPSE"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HPSE"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HPSE"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HPSE Antibody - N-terminal region (ARP60766_P050)
Your Rating
We found other products you might like!