HOXC4 Antibody - N-terminal region (ARP31957_T100)

Catalog No: ARP31957_T100

WB Suggested Anti-HOXC4 Antibody Titration: 2.0ug/ml
Positive Control: Human Liver

Host: Mouse
Target Name: HOXC4
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC4
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-HOXC4 (ARP31957_T100) antibody is Catalog # AAP31957 (Previous Catalog # AAPP02854)
• Reference: Schaffer,A., et al., (2003) J. Biol. Chem. 278 (25), 23141-23150

Target Info

• Gene Symbol: HOXC4
• Gene Full Name: Homeobox C4
• Alias Symbols: HOX3, cp19, HOX3E
• NCBI Gene Id: 3221
• Protein Name: Homeobox protein Hox-C4
• Description of Target: HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5' non-coding exon.
• Uniprot ID: P09017
• Protein Accession #: NP_705897
• Nucleotide Accession #: NM_153633
• Protein Size (# AA): 264
• Molecular Weight: 29kDa
• Protein Interactions: NCK2; PRMT6; WHSC1L1; PRMT5; SUV39H1; LYN; ELMOD2; RNF32; HTT; XRCC5; POU2F1; XRCC6; SOX10; PRKDC;