HLA-DRB1 Antibody - middle region (ARP80266_P050)

Catalog No: ARP80266_P050

Host: Rabbit
Target Name: HLA-DRB1
Sample Tissue: Human COLO205 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLA-DRB1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HLA-DRB1 (ARP80266_P050) antibody is Catalog # AAP80266

Target Info

• Gene Symbol: HLA-DRB1
• Gene Full Name: major histocompatibility complex, class II, DR beta 1
• Alias Symbols: SS1, DRB1, HLA-DRB, HLA-DR1B
• NCBI Gene Id: 3123
• Protein Name: major histocompatibility complex, class II, DR beta 1
• Description of Target: HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9.
• Uniprot ID: P04229
• Protein Accession #: NP_002115.2
• Nucleotide Accession #: NM_002124.3
• Protein Size (# AA): 266
• Molecular Weight: 30 kDa