Search Antibody, Protein, and ELISA Kit Solutions

HKR1 Antibody - C-terminal region (ARP40041_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40041_P050-FITC Conjugated

ARP40041_P050-HRP Conjugated

ARP40041_P050-Biotin Conjugated

Gene Symbol:
HKR1
Official Gene Full Name:
HKR1, GLI-Kruppel zinc finger family member
NCBI Gene Id:
284459
Protein Name:
Krueppel-related zinc finger protein 1
Swissprot Id:
Q6PJD0
Protein Accession #:
NP_861451
Nucleotide Accession #:
NM_181786
Alias Symbols:
ZNF875
Replacement Item:
This antibody may replace item sc-138953 from Santa Cruz Biotechnology.
Description of Target:
HKR1 is one of the GLI-Kruppel family of human genes. Members of this family have similar H-C links, i.e., a conserved stretch of 9 amino acids connecting the C-terminal histidine of one finger to the N-terminal cysteine of the next. On the basis of amino acid sequence and intron-exon organization, the genes could be placed into one of two subgroups: the GLI subgroup (with the consensus finger amino acid sequence [Y/F]XCX3GCX3[F/Y]X5LX2HX3-4H[T/S]GEKP) or the Kr subgroup (with the consensus finger amino acid sequence [Y/F]XCX2CX3FX5LX2HXRXHTGEKP).
Protein Size (# AA):
659
Molecular Weight:
75kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HKR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HKR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human HKR1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-HKR1 (ARP40041_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CDK11A;
Blocking Peptide:
For anti-HKR1 (ARP40041_P050) antibody is Catalog # AAP40041 (Previous Catalog # AAPP21943)
Datasheets/Manuals:
Printable datasheet for anti-HKR1 (ARP40041_P050) antibody
Target Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...