SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP88998_P050
Price: $0.00
SKU
ARP88998_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HES1 (ARP88998_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse HES1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: KNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQL
Concentration0.5 mg/ml
Blocking PeptideFor anti-HES1 (ARP88998_P050) antibody is Catalog # AAP88998
Gene SymbolHES1
Gene Full Namehairy and enhancer of split 1 (Drosophila)
Alias SymbolsHr, Hry, bHLHb3, bHLHb39
NCBI Gene Id15205
Protein Nametranscription factor HES-1
Description of TargetTranscriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1 (By similarity). Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity).
Uniprot IDP35428
Protein Accession #NP_032261.1
Nucleotide Accession #NM_008235.2
Protein Size (# AA)282
Molecular Weight31 kDa
  1. What is the species homology for "HES1 Antibody - N-terminal region (ARP88998_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "HES1 Antibody - N-terminal region (ARP88998_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "HES1 Antibody - N-terminal region (ARP88998_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HES1 Antibody - N-terminal region (ARP88998_P050)"?

    This target may also be called "Hr, Hry, bHLHb3, bHLHb39" in publications.

  5. What is the shipping cost for "HES1 Antibody - N-terminal region (ARP88998_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HES1 Antibody - N-terminal region (ARP88998_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HES1 Antibody - N-terminal region (ARP88998_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HES1 Antibody - N-terminal region (ARP88998_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HES1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HES1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HES1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HES1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HES1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HES1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HES1 Antibody - N-terminal region (ARP88998_P050)
Your Rating