Search Antibody, Protein, and ELISA Kit Solutions

Hdac4 Antibody - C-terminal region (ARP43602_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43602_P050-FITC Conjugated

ARP43602_P050-HRP Conjugated

ARP43602_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
CHIP, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Hdac4
NCBI Gene Id:
208727
Protein Name:
Histone deacetylase 4
Swissprot Id:
Q6NZM9
Protein Accession #:
NP_997108
Nucleotide Accession #:
NM_207225
Alias Symbols:
4932408F19Rik, AI047285
Replacement Item:
This antibody may replace item sc-11418 from Santa Cruz Biotechnology.
Description of Target:
Hdac4 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.
Protein Size (# AA):
1076
Molecular Weight:
118kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Hdac4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Hdac4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 93%
Complete computational species homology data:
Anti-Hdac4 (ARP43602_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Rfxank; Mef2d; Mef2c; Mef2a; Dnajb6; Tnf; Runx2; Myocd; Ppp2ca; Gli2; Creb1; Atm; Ywhab; Ifrd1;
Blocking Peptide:
For anti-Hdac4 (ARP43602_P050) antibody is Catalog # AAP43602
Datasheets/Manuals:
Printable datasheet for anti-Hdac4 (ARP43602_P050) antibody

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: Hdac4 Antibody-C-terminal region (ARP43602_P050) in mouse brain using Western blot
Product Page for Hdac4 Antibody-C-terminal region (ARP43602_P050)

Researcher: Wen-Cheng Xiong, Georgia Health Sciences University
Application: Western blotting
Species + Tissue/Cell type:
Lane 1: 40ug mouse brain, synaptosome lysate
Lane 2: 40ug mouse brain, membrane fraction
Lane 3: 40ug mouse brain, cytoplasm fraction
Lane 4: 40ug mouse brain, nuclear fraction
Lane 5: 40ug mouse brain, post synaptic density fraction
Lane 6: 40ug mouse brain, synaptosome lysate
Lane 7: 40ug mouse brain, membrane fraction
Lane 8: 40ug mouse brain, cytoplasm fraction
Lane 9: 40ug mouse brain, nuclear fraction
Primary antibody dilution: 1:1000
Secondary antibody: Goat anti-rabbit HRP
Secondary antibody dilution: 1:2000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? To test HDAC4 expression in the brain.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes
How did you store the antibody after re-suspension?  -20 C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): 1)Mus Musculus 2) Brain 3) 40 mg
How many different experimental trials were conducted using the antibody sample? One
How was this sample prepared? Sub-cellular fractionation
Primary antibody dilution and incubation time: 1:1000, 4 C overnight
Secondary antibody used and dilution and incubation time: Goat anti Rabbit, 1:2000, 2 hrs
What controls were used in your experiment (positive/negative)? Positive
Please include your detailed WB Procedure/Protocol here: Running the gel
1. After flash spinning the samples, load into the wells (40mg/well).
2. Be sure to use markers.
We use 5 ul Bio-Rad Prestained Standards Broad Range (#161-0318) directly.
3. Run with constant voltage (80-100 V).
4. Usual running time is about 2-2.5 hr.
Membrane transfer
1. Cut a piece of nitrocellulose membrane. (Schleicher&Schuell PROTRAN BA83).
2. Assemble "sandwich" for Bio-Rad's Transblot.
3. Prewet the sponges, filter papers (slightly bigger than gel) in 1x Transferring
buffer.
Sponge - filter paper - gel - membrane - filter paper - sponge
Make sure gel side facing cathode (Black)
4. Run for 220mA constant for 2 1/2 hr/over night 30V constant with the cold pack and prechilled
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...