Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP43602_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43602_P050-FITC Conjugated

ARP43602_P050-HRP Conjugated

ARP43602_P050-Biotin Conjugated

Hdac4 Antibody - C-terminal region (ARP43602_P050)

Rating:
100% of 100
Catalog#: ARP43602_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationCHIP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-11418 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 93%
Complete computational species homology dataAnti-Hdac4 (ARP43602_P050)
Peptide SequenceSynthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Hdac4 (ARP43602_P050) antibody is Catalog # AAP43602
Datasheets/ManualsPrintable datasheet for anti-Hdac4 (ARP43602_P050) antibody
Gene SymbolHdac4
Alias Symbols4932408F19Rik, AI047285
NCBI Gene Id208727
Protein NameHistone deacetylase 4
Description of TargetHdac4 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.
Swissprot IdQ6NZM9
Protein Accession #NP_997108
Nucleotide Accession #NM_207225
Protein Size (# AA)1076
Molecular Weight118kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Hdac4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Hdac4.
Protein InteractionsRfxank; Mef2d; Mef2c; Mef2a; Dnajb6; Tnf; Runx2; Myocd; Ppp2ca; Gli2; Creb1; Atm; Ywhab; Ifrd1;
Write Your Own Review
You're reviewing:Hdac4 Antibody - C-terminal region (ARP43602_P050)
Your Rating
Assay Development
Aviva ChIP Antibodies
Aviva Tips and Tricks
Aviva HIS tag Deal