H2AFX Antibody - N-terminal region (ARP89481_P050)

Catalog No: ARP89481_P050

Host: Rabbit
Target Name: H2AFX
Sample Tissue: Mouse SP2/0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse H2AFX
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-H2AFX (ARP89481_P050) antibody is Catalog # AAP89481

Target Info

• Gene Symbol: H2AFX
• Gene Full Name: H2A histone family, member X
• Alias Symbols: H2A., H2af, H2A.X, H2afx, Hist5-, gammaH, AW228881, Hist5-2ax, gammaH2ax
• NCBI Gene Id: 15270
• Protein Name: histone H2AX
• Description of Target: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family.
• Uniprot ID: P27661
• Protein Accession #: NP_034566.1
• Nucleotide Accession #: NM_010436.2
• Protein Size (# AA): 143
• Molecular Weight: 15 kDa