GUK1 Recombinant Protein (Human) (OPCA04215)

Catalog No: OPCA04215

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
• Protein Sequence: SGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 2-197 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Human guanylate kinase (GUK1): cDNA sequence, expression and chromosomal localisation.Fitzgibbon J., Katsanis N., Wells D., Delhanty J., Vallins W., Hunt D.M.FEBS Lett. 385:185-188(1996)

Target Info

• Gene Symbol: GUK1
• Gene Full Name: guanylate kinase 1
• Alias Symbols: ATP:GMP phosphotransferase;GMK;GMP kinase;guanylate kinase.
• NCBI Gene Id: 2987
• Protein Name: Guanylate kinase
• Description of Target: Essential for recycling GMP and indirectly, cGMP.
• Uniprot ID: Q16774
• Protein Accession #: NP_000849
• Nucleotide Accession #: NM_000858
• Protein Size (# AA): Recombinant
• Molecular Weight: 37.6 kDa