Catalog No: OPCA03990
Price: $0.00
SKU
OPCA03990
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for GRA1 Recombinant Protein (Toxoplasma gondii) (OPCA03990) (OPCA03990) |
---|
Predicted Species Reactivity | Toxoplasma gondii |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Toxoplasma gondii |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE |
Protein Sequence | AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 25-190 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Molecular characterization of a 23-kilodalton major antigen secreted by Toxoplasma gondii.Cesbron-Delauw M.-F., Guy B., Torpier G., Pierce R.J., Lenzen G., Cesbron J.Y., Charif H., Lepage P., Darcy F., Lecocq J.-P., Capron A.Proc. Natl. Acad. Sci. U.S.A. 86:7537-7541(1989) |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review