GMNN Antibody - middle region (ARP87436_P050)

Catalog No: ARP87436_P050

Host: Rabbit
Target Name: GMNN
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GMNN
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GMNN (ARP87436_P050) antibody is Catalog # AAP87436

Target Info

• Gene Symbol: GMNN
• Gene Full Name: geminin, DNA replication inhibitor
• Alias Symbols: Gem, MGORS6
• NCBI Gene Id: 51053
• Protein Name: geminin
• Description of Target: This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-replication complex. The encoded protein is expressed during the S and G2 phases of the cell cycle and is degraded by the anaphase-promoting complex during the metaphase-anaphase transition. Increased expression of this gene may play a role in several malignancies including colon, rectal and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and two pseudogenes of this gene are located on the short arm of chromosome 16.
• Uniprot ID: O75496
• Protein Accession #: NP_001238918.1
• Nucleotide Accession #: NM_001251989.1
• Protein Size (# AA): 209
• Molecular Weight: 22 kDa