G6PD2 Antibody - middle region (ARP94787_P050)

Catalog No: ARP94787_P050

Host: Rabbit
Target Name: G6PD2
Sample Tissue: Mouse Small Intestine lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse G6PD2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: QYDDPASYKHLNSYINALHQGMQANHLFYLALPPTVYEAVTKNIQETCMS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-G6PD2 (ARP94787_P050) antibody is Catalog # AAP94787

Target Info

• Gene Symbol: G6PD2
• Gene Full Name: glucose-6-phosphate dehydrogenase 2
• Alias Symbols: Gpd, Gpd-, Gpd2, Gpd-2, G6pdx-, G6pdx-ps1
• NCBI Gene Id: 14380
• Protein Name: Glucose-6-phosphate 1-dehydrogenase 2
• Description of Target: Catalyzes the rate-limiting step of the oxidative pentose-phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis.
• Uniprot ID: P97324
• Protein Accession #: NP_062341.2
• Nucleotide Accession #: NM_019468.2
• Protein Size (# AA): 513
• Molecular Weight: 59 kDa