Search Antibody, Protein, and ELISA Kit Solutions

FJX1 Antibody - N-terminal region (ARP47013_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP47013_P050-FITC Conjugated

ARP47013_P050-HRP Conjugated

ARP47013_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Four jointed box 1 (Drosophila)
NCBI Gene Id:
Protein Name:
Four-jointed box protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ22416, FLJ25593
Replacement Item:
This antibody may replace item sc-167900 from Santa Cruz Biotechnology.
Description of Target:
FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known..The protein encoded by this gene is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of this gene in humans is not known.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FJX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FJX1.
The immunogen is a synthetic peptide directed towards the N terminal region of human FJX1
Predicted Homology Based on Immunogen Sequence:
Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-FJX1 (ARP47013_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FJX1 (ARP47013_P050) antibody is Catalog # AAP47013 (Previous Catalog # AAPP27814)
Printable datasheet for anti-FJX1 (ARP47013_P050) antibody
Target Reference:
Gawin,B., (1999) Genome Res. 9 (11), 1074-1086

Chai, SJ; Yap, YY; Foo, YC; Yap, LF; Ponniah, S; Teo, SH; Cheong, SC; Patel, V; Lim, KP; Identification of Four-Jointed Box 1 (FJX1)-Specific Peptides for Immunotherapy of Nasopharyngeal Carcinoma. 10, e0130464 (2015). WB, Dog, Guinea Pig, Human, Mouse, Rat 26536470

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...