Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP47013_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47013_P050-FITC Conjugated

ARP47013_P050-HRP Conjugated

ARP47013_P050-Biotin Conjugated

FJX1 Antibody - N-terminal region (ARP47013_P050)

Catalog#: ARP47013_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-167900 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FJX1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-FJX1 (ARP47013_P050)
Peptide Sequence Synthetic peptide located within the following region: MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FJX1 (ARP47013_P050) antibody is Catalog # AAP47013 (Previous Catalog # AAPP27814)
Datasheets/Manuals Printable datasheet for anti-FJX1 (ARP47013_P050) antibody
Target Reference Gawin,B., (1999) Genome Res. 9 (11), 1074-1086
Publications

Chai, SJ; Yap, YY; Foo, YC; Yap, LF; Ponniah, S; Teo, SH; Cheong, SC; Patel, V; Lim, KP; Identification of Four-Jointed Box 1 (FJX1)-Specific Peptides for Immunotherapy of Nasopharyngeal Carcinoma. 10, e0130464 (2015). WB, Dog, Guinea Pig, Human, Mouse, Rat 26536470

Gene Symbol FJX1
Official Gene Full Name Four jointed box 1 (Drosophila)
Alias Symbols FLJ22416, FLJ25593
NCBI Gene Id 24147
Protein Name Four-jointed box protein 1
Description of Target FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known..The protein encoded by this gene is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of this gene in humans is not known.
Swissprot Id Q86VR8
Protein Accession # NP_055159
Nucleotide Accession # NM_014344
Protein Size (# AA) 437
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FJX1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FJX1.
Protein Interactions DKKL1; PIGN;
Write Your Own Review
You're reviewing:FJX1 Antibody - N-terminal region (ARP47013_P050)
Your Rating