Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP34506_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34506_T100-FITC Conjugated

ARP34506_T100-HRP Conjugated

ARP34506_T100-Biotin Conjugated

FHL2 Antibody - C-terminal region (ARP34506_T100)

Catalog#: ARP34506_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-13409, HPA006028
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FHL2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Complete computational species homology data Anti-FHL2 (ARP34506_T100)
Peptide Sequence Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FHL2 (ARP34506_T100) antibody is Catalog # AAP34506 (Previous Catalog # AAPY00528)
Datasheets/Manuals Printable datasheet for anti-FHL2 (ARP34506_T100) antibody
Target Reference Lee,S.W., et al., (2006) Biochem. Biophys. Res. Commun. 339 (4), 1056-1062
Publications

Han, W. et al. FHL2 interacts with and acts as a functional repressor of Id2 in human neuroblastoma cells. Nucleic Acids Res. 37, 3996-4009 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19417068

Saeki, Y. et al. Ligand-specific sequential regulation of transcription factors for differentiation of MCF-7 cells. BMC Genomics 10, 545 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19925682

Gene Symbol FHL2
Official Gene Full Name Four and a half LIM domains 2
Alias Symbols DRAL, AAG11, FHL-2, SLIM3, SLIM-3
NCBI Gene Id 2274
Protein Name Four and a half LIM domains protein 2
Description of Target FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain.
Swissprot Id Q14192
Protein Accession # NP_963849
Nucleotide Accession # NM_201555
Protein Size (# AA) 279
Molecular Weight 32kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FHL2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FHL2.
Protein Interactions SP2; RFX3; REL; NRF1; JUP; INCA1; FAM154A; ZNF417; FAM129A; GLYR1; CCDC92; ARHGAP9; KIAA1217; GNG12; DCP1A; ZFP64; BANP; KANK2; RAI2; ZMYM4; BLZF1; ZNF131; CSN2; SIGLEC6; DTX2; TRIM63; TRIM55; FOXO1; SUMO2; PTCH1; DCTN3; HEXIM1; ERP44; SMAD4; SMAD3; SMAD2
Write Your Own Review
You're reviewing:FHL2 Antibody - C-terminal region (ARP34506_T100)
Your Rating