Search Antibody, Protein, and ELISA Kit Solutions

FHL2 Antibody - C-terminal region (ARP34506_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34506_T100-FITC Conjugated

ARP34506_T100-HRP Conjugated

ARP34506_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Four and a half LIM domains 2
NCBI Gene Id:
Protein Name:
Four and a half LIM domains protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-13409, HPA006028
Description of Target:
FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FHL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FHL2.
The immunogen is a synthetic peptide directed towards the C terminal region of human FHL2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Complete computational species homology data:
Anti-FHL2 (ARP34506_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FHL2 (ARP34506_T100) antibody is Catalog # AAP34506 (Previous Catalog # AAPY00528)
Printable datasheet for anti-FHL2 (ARP34506_T100) antibody
Target Reference:
Lee,S.W., et al., (2006) Biochem. Biophys. Res. Commun. 339 (4), 1056-1062

Han, W. et al. FHL2 interacts with and acts as a functional repressor of Id2 in human neuroblastoma cells. Nucleic Acids Res. 37, 3996-4009 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19417068

Saeki, Y. et al. Ligand-specific sequential regulation of transcription factors for differentiation of MCF-7 cells. BMC Genomics 10, 545 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19925682

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...