Catalog No: ARP53165_P050
Price: $0.00
SKU
ARP53165_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FBXL16 Antibody - middle region (ARP53165_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-FBXL16 (ARP53165_P050) antibody
Product Info
ReferenceMartin,J., (2004) Nature 432 (7020), 988-994
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FBXL16
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
Concentration0.5 mg/ml
Blocking PeptideFor anti-FBXL16 (ARP53165_P050) antibody is Catalog # AAP53165 (Previous Catalog # AAPP36235)
Gene SymbolFBXL16
Gene Full NameF-box and leucine-rich repeat protein 16
Alias SymbolsFbl16, C16orf22, c380A1.1
NCBI Gene Id146330
Protein NameF-box/LRR-repeat protein 16
Description of TargetFBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Uniprot IDQ8N461
Protein Accession #NP_699181
Nucleotide Accession #NM_153350
Protein Size (# AA)479
Molecular Weight52kDa
Protein InteractionsHPCAL4; LATS2; MAPK6;
  1. What is the species homology for "FBXL16 Antibody - middle region (ARP53165_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "FBXL16 Antibody - middle region (ARP53165_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FBXL16 Antibody - middle region (ARP53165_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FBXL16 Antibody - middle region (ARP53165_P050)"?

    This target may also be called "Fbl16, C16orf22, c380A1.1" in publications.

  5. What is the shipping cost for "FBXL16 Antibody - middle region (ARP53165_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FBXL16 Antibody - middle region (ARP53165_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FBXL16 Antibody - middle region (ARP53165_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FBXL16 Antibody - middle region (ARP53165_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FBXL16"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FBXL16"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FBXL16"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FBXL16"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FBXL16"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FBXL16"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FBXL16 Antibody - middle region (ARP53165_P050)
Your Rating