FANCE Antibody - middle region (ARP55381_P050)

Catalog No: ARP55381_P050

WB Suggested Anti-FANCE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FANCE
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 79%; Horse: 85%; Human: 100%; Pig: 79%; Rabbit: 79%
• Peptide Sequence: Synthetic peptide located within the following region: SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FANCE (ARP55381_P050) antibody is Catalog # AAP55381 (Previous Catalog # AAPP33253)

Target Info

• Reference: Wang,X., (2007) Mol. Cell. Biol. 27 (8), 3098-3108
• Gene Symbol: FANCE
• Gene Full Name: Fanconi anemia, complementation group E
• Alias Symbols: FAE, FACE
• NCBI Gene Id: 2178
• Protein Name: Fanconi anemia group E protein
• Description of Target: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex.The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group E. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9HB96
• Protein Accession #: NP_068741
• Nucleotide Accession #: NM_021922
• Protein Size (# AA): 536
• Molecular Weight: 59kDa
• Protein Interactions: APITD1; STRA13; UBC; FANCG; FANCD2; FANCC; FANCA; FANCM; C1orf86; ELAVL1; Erh; FANCF; CHEK1; HES1; PCNA; BRCA2;