FANC Recombinant Protein (Escherichia coli) (OPCA03790)

Catalog No: OPCA03790

Product Info

• Predicted Species Reactivity: Escherichia coli
• Product Format: Liquid or Lyophilized powder
• Reconstitution and Storage: -20°C or -80°C
• Immunogen: 23-181aa
• Purification: Affinity purified using IMAC.
• Concentration: Varies by lot. See vial for exact concentration.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
• Protein Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 23-181 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: The role of lysine-132 and arginine-136 in the receptor-binding domain of the K99 fibrillar subunit. Jacobs A.A.C., Simons L.H., de Graaf F.K. EMBO J. 6:1805-1808(1987)

Target Info

• Gene Symbol: FANC
• Alias Symbols: fanCK99 fimbrial protein
• Protein Name: K99 fimbrial protein
• Description of Target: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.
• Uniprot ID: P18103
• Protein Size (# AA): Recombinant
• Molecular Weight: 32.5 kDa