ETF1 Antibody - N-terminal region (ARP54738_P050)

Catalog No: ARP54738_P050

WB Suggested Anti-ETF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate

Rabbit Anti-ETF1 Antibody
Catalog Number: ARP54738_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in bile ductule
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ETF1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ETF1 (ARP54738_P050) antibody is Catalog # AAP54738 (Previous Catalog # AAPP31533)
• Subunit: 1

Target Info

• Gene Symbol: ETF1
• Gene Full Name: Eukaryotic translation termination factor 1
• Alias Symbols: ERF, RF1, ERF1, TB3-1, D5S1995, SUP45L1
• NCBI Gene Id: 2107
• Protein Name: Eukaryotic peptide chain release factor subunit 1
• Description of Target: Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al., 1994 [PubMed 7990965]).
• Uniprot ID: P62495
• Protein Accession #: NP_004721
• Nucleotide Accession #: NM_004730
• Protein Size (# AA): 437
• Molecular Weight: 49kDa
• Protein Interactions: KEAP1; UBC; RTF1; NUDC; VPS26A; TSN; CORO1C; CORO1B; HECW2; ALB; UPF1; LIG4; GSPT1; PPP2CA; GSPT2; PABPC1;