Estrogen Receptor-beta Antibody (Phospho-Ser105) (OAAF07558)

Catalog No: OAAF07558 (Formerly GWB-ASB425)

Size:100 ug

Western blot analysis of lysates from HeLa cells, using Estrogen Receptor-beta (Phospho-Ser105) Antibody. The lane on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HUVEC cells, using Estrogen Receptor-beta (Phospho-Ser105) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Liquid PBS (without Mg2+ and Ca2+) pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol
• Clonality: Polyclonal
• Isotype: IgG
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot
• Additional Information: Modification Sites: Human:S105 Mouse:S105 Rat:S105
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human Estrogen Receptor-beta around the phosphorylation site of Ser105.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: RQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
• Concentration: 1 mg/ml
• Specificity: Estrogen Receptor-beta (Phospho-Ser105) Antibody detects endogenous levels of Estrogen Receptor-beta only when phosphorylated at Ser105.
• Application Info: WB: 1:500~1000
  IF: 1:100~500
  ELISA: 1:1000

Target Info

• Gene Symbol: ESR2
• Gene Full Name: estrogen receptor 2
• Alias Symbols: Erb;ER-BETA;ESRB;ESR-BETA;ESTRB;estrogen receptor beta;estrogen receptor beta 4;estrogen receptor beta splice variant, ERbeta2delta7;estrogen receptor beta splice variant, ERbeta4delta7;estrogen receptor beta splice variant, ERbeta6;estrogen receptor beta splice variant, ERbeta6delta7;estrogen receptor beta splice variant, ERbeta7;estrogen receptor beta splice variant, ERbeta7delta7;estrogen receptor beta splice variant, ERbetaEx. 4L;estrogen receptor beta splice variant, ERbetaEx. 6L;NR3A2;nuclear receptor subfamily 3 group A member 2;ODG8;oestrogen receptor beta.
• NCBI Gene Id: 2100
• Protein Name: Estrogen receptor beta
• Description of Target: Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.
• Uniprot ID: Q92731
• Molecular Weight: 59 kDa