ELAVL4 Antibody - N-terminal region (ARP40971_P050)

Catalog No: ARP40971_P050

WB Suggested Anti-ELAVL4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: NCI-H226 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ELAVL4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ELAVL4 (ARP40971_P050) antibody is Catalog # AAP40971 (Previous Catalog # AAPP22883)
• Reference: Ratti,A., (2008) J. Biol. Chem. 283 (12), 7531-7541

Target Info

• Gene Symbol: ELAVL4
• Gene Full Name: ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
• Alias Symbols: HUD, PNEM
• NCBI Gene Id: 1996
• Protein Name: ELAV-like protein 4
• Description of Target: ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
• Uniprot ID: P26378
• Protein Accession #: NP_068771
• Nucleotide Accession #: NM_021952
• Protein Size (# AA): 380
• Molecular Weight: 42kDa
• Protein Interactions: PHF20L1; UBC; SUMO1; NFX1; ELAVL2; GAP43; EWSR1; NXF1;