Search Antibody, Protein, and ELISA Kit Solutions

DPP3 Antibody - middle region (ARP85859_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DPP3
Official Gene Full Name:
dipeptidyl peptidase 3
NCBI Gene Id:
10072
Protein Name:
dipeptidyl peptidase 3
Swissprot Id:
Q9NY33-4
Protein Accession #:
NP_001243599.1
Nucleotide Accession #:
NM_001256670.1
Alias Symbols:
DPPIII
Description of Target:
This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternatively spliced transcript variants have been found for this gene.
Protein Size (# AA):
707
Molecular Weight:
77 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DPP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DPP3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DPP3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DPP3 (ARP85859_P050) antibody is Catalog # AAP85859
Datasheets/Manuals:
Printable datasheet for anti-DPP3 (ARP85859_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...