Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP85859_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

DPP3 Antibody - middle region (ARP85859_P050)

Catalog#: ARP85859_P050
Domestic: within 24 hours delivery International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DPP3
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: SGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DPP3 (ARP85859_P050) antibody is Catalog # AAP85859
Datasheets/ManualsPrintable datasheet for anti-DPP3 (ARP85859_P050) antibody
Gene SymbolDPP3
Official Gene Full Namedipeptidyl peptidase 3
Alias SymbolsDPPIII
NCBI Gene Id10072
Protein Namedipeptidyl peptidase 3
Description of TargetThis gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternatively spliced transcript variants have been found for this gene.
Swissprot IdQ9NY33-4
Protein Accession #NP_001243599.1
Nucleotide Accession #NM_001256670.1
Protein Size (# AA)707
Molecular Weight77 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DPP3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DPP3.
Write Your Own Review
You're reviewing:DPP3 Antibody - middle region (ARP85859_P050)
Your Rating
Aviva Tips and Tricks
Aviva HIS tag Deal
Aviva Blast Tool
Aviva Validation Data