Dkk4 Antibody - C-terminal region (ARP42406_P050)

Catalog No: ARP42406_P050

Host: Rabbit
Target Name: Dkk4
Antibody Dilution: 1.0ug/ml
Sample Type: Mouse Pancreas

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Dkk4 (ARP42406_P050) antibody is Catalog # AAP42406

Target Info

• Gene Symbol: Dkk4
• Gene Full Name: Dickkopf homolog 4 (Xenopus laevis)
• Alias Symbols: Dkk-4
• NCBI Gene Id: 234130
• Protein Name: Dickkopf-related protein 4
• Description of Target: Dkk4 antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
• Uniprot ID: Q8VEJ3
• Protein Accession #: NP_663567
• Nucleotide Accession #: NM_145592
• Protein Size (# AA): 221
• Molecular Weight: 24kDa