SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP70101_P050
Price: $0.00
SKU
ARP70101_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CYTH2 (ARP70101_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human CYTH2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: GRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPN
Concentration0.5 mg/ml
Blocking PeptideFor anti-CYTH2 (ARP70101_P050) antibody is Catalog # AAP70101
Gene SymbolCYTH2
Alias SymbolsARNO, CTS18, PSCD2, SEC7L, PSCD2L, CTS18.1, Sec7p-L, Sec7p-like, cytohesin-2
NCBI Gene Id9266
Protein NameCytohesin-2
Description of TargetThe protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ99418
Protein Accession #NP_059431
Nucleotide Accession #NM_017457
Protein Size (# AA)400
Molecular Weight46kDa
Protein InteractionsCCDC120; UBC; ARF6; GNAQ; PNPLA2; DYT10; MAPK6; APC; IPCEF1; ATP6V0A2; CYTIP; ARFGAP1; TRIM23; ITGB2; PRKCG; PRKCB; PRKCA; CUX1; ARRB2; ARRB1; ARF1; ADORA2A; ARF3; SFN;
  1. What is the species homology for "CYTH2 Antibody - C-terminal region (ARP70101_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "CYTH2 Antibody - C-terminal region (ARP70101_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CYTH2 Antibody - C-terminal region (ARP70101_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CYTH2 Antibody - C-terminal region (ARP70101_P050)"?

    This target may also be called "ARNO, CTS18, PSCD2, SEC7L, PSCD2L, CTS18.1, Sec7p-L, Sec7p-like, cytohesin-2" in publications.

  5. What is the shipping cost for "CYTH2 Antibody - C-terminal region (ARP70101_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CYTH2 Antibody - C-terminal region (ARP70101_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CYTH2 Antibody - C-terminal region (ARP70101_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CYTH2 Antibody - C-terminal region (ARP70101_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CYTH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CYTH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CYTH2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CYTH2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CYTH2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CYTH2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CYTH2 Antibody - C-terminal region (ARP70101_P050)
Your Rating