Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP34181_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34181_P050-FITC Conjugated

ARP34181_P050-HRP Conjugated

ARP34181_P050-Biotin Conjugated

CSRP3 Antibody - middle region (ARP34181_P050)

Catalog#: ARP34181_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CSRP3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-CSRP3 (ARP34181_P050)
Peptide Sequence Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CSRP3 (ARP34181_P050) antibody is Catalog # AAP34181 (Previous Catalog # AAPP05443)
Datasheets/Manuals Printable datasheet for anti-CSRP3 (ARP34181_P050) antibody
Target Reference Geier,C., et al., (2003) Circulation 107 (10), 1390-1395
Publications

Roberts, M. D., Childs, T. E., Brown, J. D., Davis, J. W. & Booth, F. W. Early depression of Ankrd2 and Csrp3 mRNAs in the polyribosomal and whole tissue fractions in skeletal muscle with decreased voluntary running. J. Appl. Physiol. 112, 1291-9 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22282489

Gene Symbol CSRP3
Official Gene Full Name Cysteine and glycine-rich protein 3 (cardiac LIM protein)
Alias Symbols CLP, MLP, CRP3, LMO4, CMD1M, CMH12
NCBI Gene Id 8048
Protein Name Cysteine and glycine-rich protein 3
Description of Target The CSRP3 gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in CSRP3 are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans.
Swissprot Id P50461
Protein Accession # NP_003467
Nucleotide Accession # NM_003476
Protein Size (# AA) 194
Molecular Weight 21kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CSRP3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CSRP3.
Protein Interactions UBC; HDAC4; LDHD; SPTB; NHLH1; MYF6; MYOG; MYOD1; ACTN1;
  1. What is the species homology for "CSRP3 Antibody - middle region (ARP34181_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "CSRP3 Antibody - middle region (ARP34181_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CSRP3 Antibody - middle region (ARP34181_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSRP3 Antibody - middle region (ARP34181_P050)"?

    This target may also be called "CLP, MLP, CRP3, LMO4, CMD1M, CMH12" in publications.

  5. What is the shipping cost for "CSRP3 Antibody - middle region (ARP34181_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSRP3 Antibody - middle region (ARP34181_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSRP3 Antibody - middle region (ARP34181_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSRP3 Antibody - middle region (ARP34181_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CSRP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CSRP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CSRP3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CSRP3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CSRP3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CSRP3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSRP3 Antibody - middle region (ARP34181_P050)
Your Rating
We found other products you might like!