CSRP3 Antibody - middle region (ARP34181_P050)

Catalog No: ARP34181_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-CSRP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart

Host: Rabbit
Target Name: CSRP3
Sample Tissue: Human HCT116 Whole Cell
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: CSRP3
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 0.5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSRP3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CSRP3 (ARP34181_P050) antibody is Catalog # AAP34181 (Previous Catalog # AAPP05443)
• Reference: Geier,C., et al., (2003) Circulation 107 (10), 1390-1395
• Publications:

  Roberts, M. D., Childs, T. E., Brown, J. D., Davis, J. W. & Booth, F. W. Early depression of Ankrd2 and Csrp3 mRNAs in the polyribosomal and whole tissue fractions in skeletal muscle with decreased voluntary running. J. Appl. Physiol. 112, 1291-9 (2012). 22282489

Target Info

• Gene Symbol: CSRP3
• Gene Full Name: Cysteine and glycine-rich protein 3 (cardiac LIM protein)
• Alias Symbols: CLP, MLP, CRP3, LMO4, CMD1M, CMH12
• NCBI Gene Id: 8048
• Protein Name: Cysteine and glycine-rich protein 3
• Description of Target: The CSRP3 gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in CSRP3 are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans.
• Uniprot ID: P50461
• Protein Accession #: NP_003467
• Nucleotide Accession #: NM_003476
• Protein Size (# AA): 194
• Molecular Weight: 21kDa
• Protein Interactions: UBC; HDAC4; LDHD; SPTB; NHLH1; MYF6; MYOG; MYOD1; ACTN1;