- Gene Symbol:
- CSRP3
- NCBI Gene Id:
- 8048
- Official Gene Full Name:
- Cysteine and glycine-rich protein 3 (cardiac LIM protein)
- Protein Name:
- Cysteine and glycine-rich protein 3
- Swissprot Id:
- P50461
- Protein Accession #:
- NP_003467
- Nucleotide Accession #:
- NM_003476
- Alias Symbols:
- CLP, MLP, CRP3, LMO4, CMD1M, CMH12
- Description of Target:
- The CSRP3 gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in CSRP3 are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans.
- Protein Size (# AA):
- 194
- Molecular Weight:
- 21kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CSRP3.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CSRP3.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human CSRP3
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
- Complete computational species homology data:
- Anti-CSRP3 (ARP34181_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- UBC; HDAC4; LDHD; SPTB; NHLH1; MYF6; MYOG; MYOD1; ACTN1;
- Blocking Peptide:
- For anti-CSRP3 (ARP34181_P050) antibody is Catalog # AAP34181 (Previous Catalog # AAPP05443)
- Datasheets/Manuals:
- Printable datasheet for anti-CSRP3 (ARP34181_P050) antibody
- Target Reference:
- Geier,C., et al., (2003) Circulation 107 (10), 1390-1395
- Publications:
Roberts, M. D., Childs, T. E., Brown, J. D., Davis, J. W. & Booth, F. W. Early depression of Ankrd2 and Csrp3 mRNAs in the polyribosomal and whole tissue fractions in skeletal muscle with decreased voluntary running. J. Appl. Physiol. 112, 1291-9 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22282489
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
