Search Antibody, Protein, and ELISA Kit Solutions

CSRP3 antibody - middle region (ARP34181_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34181_P050-FITC Conjugated

ARP34181_P050-HRP Conjugated

ARP34181_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CSRP3
NCBI Gene Id:
8048
Official Gene Full Name:
Cysteine and glycine-rich protein 3 (cardiac LIM protein)
Protein Name:
Cysteine and glycine-rich protein 3
Swissprot Id:
P50461
Protein Accession #:
NP_003467
Nucleotide Accession #:
NM_003476
Alias Symbols:
CLP, MLP, CRP3, LMO4, CMD1M, CMH12
Description of Target:
The CSRP3 gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in CSRP3 are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans.
Protein Size (# AA):
194
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CSRP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CSRP3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CSRP3
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CSRP3 (ARP34181_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; HDAC4; LDHD; SPTB; NHLH1; MYF6; MYOG; MYOD1; ACTN1;
Blocking Peptide:
For anti-CSRP3 (ARP34181_P050) antibody is Catalog # AAP34181 (Previous Catalog # AAPP05443)
Datasheets/Manuals:
Printable datasheet for anti-CSRP3 (ARP34181_P050) antibody
Target Reference:
Geier,C., et al., (2003) Circulation 107 (10), 1390-1395
Publications:

Roberts, M. D., Childs, T. E., Brown, J. D., Davis, J. W. & Booth, F. W. Early depression of Ankrd2 and Csrp3 mRNAs in the polyribosomal and whole tissue fractions in skeletal muscle with decreased voluntary running. J. Appl. Physiol. 112, 1291-9 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22282489

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...