SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP70064_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP70064_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-CSRNP2 (ARP70064_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Rat, Dog, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human CSRNP2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Human: 100%; Rabbit: 75%; Rat: 83%
Peptide SequenceSynthetic peptide located within the following region: EPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLA
Concentration0.5 mg/ml
Blocking PeptideFor anti-CSRNP2 (ARP70064_P050-HRP) antibody is Catalog # AAP70064
Gene SymbolCSRNP2
Alias SymbolsC12orf2, PPP1R72, TAIP-12, C12orf22, FAM130A1
NCBI Gene Id81566
Protein NameCysteine/serine-rich nuclear protein 2
Description of TargetThe protein encoded by this gene belongs to the CSRNP family of nuclear proteins that share conserved regions, including cysteine- and serine- rich regions, a basic domain, a transcriptional activation domain, and bind the sequence 'AGAGTG', thus have the hallmark of transcription factors. Studies in mice suggest that these genes may have redundant functions. Alternatively spliced transcript variants have been found for this gene.
Uniprot IDQ9H175
Protein Accession #NP_110436
Nucleotide Accession #NM_030809
Protein Size (# AA)543
Molecular Weight59kDa
Protein InteractionsPPP1CC; PPP1CB; PPP1CA;
  1. What is the species homology for "CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Rat, Dog, Rabbit".

  2. How long will it take to receive "CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)"?

    This target may also be called "C12orf2, PPP1R72, TAIP-12, C12orf22, FAM130A1" in publications.

  5. What is the shipping cost for "CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "59kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CSRNP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CSRNP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CSRNP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CSRNP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CSRNP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CSRNP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSRNP2 Antibody - C-terminal region : HRP (ARP70064_P050-HRP)
Your Rating