CSHL1 Antibody - C-terminal region (ARP41935_P050)

Catalog No: ARP41935_P050

WB Suggested Anti-CSHL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CSHL1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CSHL1 (ARP41935_P050) antibody is Catalog # AAP41935 (Previous Catalog # AAPP24472)
• Reference: Sigal,E., (1994) J. Biol. Chem. 269 (37), 23220-23229

Target Info

• Gene Symbol: CSHL1
• Gene Full Name: Chorionic somatomammotropin hormone-like 1
• Alias Symbols: CSL, CS-5, GHB4, CSHP1, hCS-L
• NCBI Gene Id: 1444
• Protein Name: Chorionic somatomammotropin hormone-like 1
• Description of Target: CSHL1 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: Q14406
• Protein Accession #: NP_072103
• Nucleotide Accession #: NM_022581
• Protein Size (# AA): 199
• Molecular Weight: 20kDa
• Protein Interactions: MAML2; MAML3;