SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP91093_P050
Price: $0.00
SKU
ARP91093_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CRMP1 (ARP91093_P050) antibody
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse CRMP1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: APSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGR
Concentration0.5 mg/ml
Blocking PeptideFor anti-CRMP1 (ARP91093_P050) antibody is Catalog # AAP91093
Gene SymbolCRMP1
Gene Full Namecollapsin response mediator protein 1
Alias SymbolsUl, DRP, DRP-1, Ulip3, CRMP-1, Dpysl1, ULIP-3
NCBI Gene Id12933
Protein Namedihydropyrimidinase-related protein 1
Description of TargetThis gene encodes a protein that is part of the collapsin response mediator protein family. The family is comprised of five, homologous cytosolic phosphoproteins that are expressed in developing and adult nervous tissue and mediate signaling to transduce responses to extracellular cues. This protein is a Semaphorin 3A signaling molecule that regulates collapse of the growth cone. The growth cone mediates axonal pathfinding in neurons. This protein is reported to represent a new class of microtubule-associated proteins. In humans this protein is reported to inhibit cancer cell invasion. In mouse deficiency of this gene may be associated with impaired spatial memory performance. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Uniprot IDP97427
Protein Accession #NP_031791.3
Nucleotide Accession #NM_007765.4
Protein Size (# AA)572
Molecular Weight62 kDa
  1. What is the species homology for "CRMP1 Antibody - C-terminal region (ARP91093_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "CRMP1 Antibody - C-terminal region (ARP91093_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "CRMP1 Antibody - C-terminal region (ARP91093_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CRMP1 Antibody - C-terminal region (ARP91093_P050)"?

    This target may also be called "Ul, DRP, DRP-1, Ulip3, CRMP-1, Dpysl1, ULIP-3" in publications.

  5. What is the shipping cost for "CRMP1 Antibody - C-terminal region (ARP91093_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CRMP1 Antibody - C-terminal region (ARP91093_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CRMP1 Antibody - C-terminal region (ARP91093_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "62 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CRMP1 Antibody - C-terminal region (ARP91093_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CRMP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CRMP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CRMP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CRMP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CRMP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CRMP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CRMP1 Antibody - C-terminal region (ARP91093_P050)
Your Rating