CREBZF Antibody - C-terminal region (ARP36001_T100)

Catalog No: ARP36001_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-CREBZF Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: CCRF-CEM cell lysateCREBZF is strongly supported by BioGPS gene expression data to be expressed in Human CCRT-CEM cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CREBZF
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: TSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCS
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-CREBZF (ARP36001_T100) antibody is Catalog # AAP36001 (Previous Catalog # AAPP07311)
• Sample Type Confirmation:

  CREBZF is strongly supported by BioGPS gene expression data to be expressed in CCRT-CEM

Target Info

• Gene Symbol: CREBZF
• Gene Full Name: CREB/ATF bZIP transcription factor
• Alias Symbols: ZF, SMILE
• NCBI Gene Id: 58487
• Protein Name: CREB/ATF bZIP transcription factor
• Description of Target: CREBZF strongly activates transcription when bound to HCFC1. CREBZF suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. It also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. It is able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
• Uniprot ID: Q9NS37
• Protein Accession #: AAD28325
• Nucleotide Accession #: NM_001039618
• Protein Size (# AA): 272
• Molecular Weight: 29kDa
• Protein Interactions: TTC23; CTNNBL1; ACYP2; TP53; CREBZF; XBP1; NFE2L1; ATF6B; ATF4; HCFC1; ZNF512B; CREB3L3; PPARGC1A; ELAVL1; UBC;