Search Antibody, Protein, and ELISA Kit Solutions

Cpne7 Antibody - C-terminal region (ARP55052_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55052_P050-FITC Conjugated

ARP55052_P050-HRP Conjugated

ARP55052_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Cpne7
Official Gene Full Name:
Copine VII
NCBI Gene Id:
361433
Protein Name:
Copine VII (Predicted), isoform CRA_b EMBL EDL92784.1
Swissprot Id:
D3ZWR4
Protein Accession #:
NP_001101924
Nucleotide Accession #:
NM_001108454
Alias Symbols:
Cpne7
Description of Target:
The function of Cpne7 remains unknow.
Protein Size (# AA):
486
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Cpne7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Cpne7.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 93%; Zebrafish: 92%
Complete computational species homology data:
Anti-Cpne7 (ARP55052_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Cpne7 (ARP55052_P050) antibody is Catalog # AAP55052 (Previous Catalog # AAPP32661)
Datasheets/Manuals:
Printable datasheet for anti-Cpne7 (ARP55052_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...