Catalog No: ARP52491_P050
Price: $0.00
SKU
ARP52491_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CIB3 Antibody - N-terminal region (ARP52491_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CIB3 (ARP52491_P050) antibody
Product Info
ReferenceGentry,H.R., (2005) J. Biol. Chem. 280 (9), 8407-8415
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CIB3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 75%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CIB3 (ARP52491_P050) antibody is Catalog # AAP52491 (Previous Catalog # AAPP30405)
Gene SymbolCIB3
Gene Full NameCalcium and integrin binding family member 3
Alias SymbolsKIP3
NCBI Gene Id117286
Protein NameCalcium and integrin-binding family member 3
Description of TargetThe specific function of CIB3 is not yet known.This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function of this gene is not known. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-635 AB050868.1 1-635 636-661 AW295492.1 15-40 c
Uniprot IDQ96Q77
Protein Accession #NP_473454
Nucleotide Accession #NM_054113
Protein Size (# AA)187
Molecular Weight22kDa
Protein InteractionsTACC3; BEND7; CCDC155; KLF17; LNX1; ZNF426; GMCL1; ZNF398; SERTAD1; TRIM2; ENOX2; SP4; REL; MEOX2; MEOX1; AES;
  1. What is the species homology for "CIB3 Antibody - N-terminal region (ARP52491_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "CIB3 Antibody - N-terminal region (ARP52491_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CIB3 Antibody - N-terminal region (ARP52491_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CIB3 Antibody - N-terminal region (ARP52491_P050)"?

    This target may also be called "KIP3" in publications.

  5. What is the shipping cost for "CIB3 Antibody - N-terminal region (ARP52491_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CIB3 Antibody - N-terminal region (ARP52491_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CIB3 Antibody - N-terminal region (ARP52491_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CIB3 Antibody - N-terminal region (ARP52491_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CIB3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CIB3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CIB3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CIB3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CIB3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CIB3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CIB3 Antibody - N-terminal region (ARP52491_P050)
Your Rating