CFI Antibody - C-terminal region (ARP71464_P050)

Catalog No: ARP71464_P050

Host: Rabbit
Target Name: CFI
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CFI
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 77%; Guinea Pig: 79%; Horse: 83%; Human: 100%; Mouse: 86%; Pig: 85%; Rabbit: 83%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: AGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CFI (ARP71464_P050) antibody is Catalog # AAP71464

Target Info

• Gene Symbol: CFI
• Alias Symbols: FI, IF, KAF, AHUS3, ARMD13, C3BINA, C3b-INA
• NCBI Gene Id: 3426
• Description of Target: This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uraemic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immmune deposits is another condition associated with mutation of this gene.
• Uniprot ID: P05156
• Protein Accession #: NP_000195
• Nucleotide Accession #: NM_000204
• Protein Size (# AA): 583
• Molecular Weight: 64kDa
• Protein Interactions: GLP1R; CFH; C3;