Search Antibody, Protein, and ELISA Kit Solutions

CCT4 Antibody - C-terminal region (ARP34271_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34271_P050-FITC Conjugated

ARP34271_P050-HRP Conjugated

ARP34271_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Chaperonin containing TCP1, subunit 4 (delta)
NCBI Gene Id:
Protein Name:
T-complex protein 1 subunit delta
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-137092 from Santa Cruz Biotechnology.
Description of Target:
The CCT (chaperonin containing TCP-1) complex functions as a molecular chaperone in the eukaryotic cytosol. CCT4 interacts with human cyclin E which has been implicated in positive control of the G1/S phase transition.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCT4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCT4.
The immunogen is a synthetic peptide directed towards the C terminal region of human CCT4
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-CCT4 (ARP34271_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CCT4 (ARP34271_P050) antibody is Catalog # AAP34271 (Previous Catalog # AAPP05621)
Printable datasheet for anti-CCT4 (ARP34271_P050) antibody
Sample Type Confirmation:

CCT4 is supported by BioGPS gene expression data to be expressed in HEK293, HEK293T, HepG2

Target Reference:
Parissi,V., et al., (2001) J. Virol. 75 (23), 11344-11353

Laux, A. et al. Localization of endogenous morphine-like compounds in the mouse spinal cord. J. Comp. Neurol. 520, 1547-61 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22133715

Tarkar, A. et al. DYX1C1 is required for axonemal dynein assembly and ciliary motility. Nat. Genet. 45, 995-1003 (2013). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23872636

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...