CBLL2 Antibody - N-terminal region (ARP36191_P050)

Catalog No: ARP36191_P050

WB Suggested Anti-ZNF645 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF645
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPGYRWGDIKINIIGEKD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CBLL2 (ARP36191_P050) antibody is Catalog # AAP36191 (Previous Catalog # AAPP07546)
• Reference: Sugano,S. Unpublished (2002)
• Publications:

  Bai, G. et al. Promoter demethylation mediates the expression of ZNF645, a novel cancer/testis gene. BMB Rep. 43, 400-6 (2010). 20587329

  Liu, Y.-Q. et al. Human RING finger protein ZNF645 is a novel testis-specific E3 ubiquitin ligase. Asian J. Androl. 12, 658-66 (2010). 20657603

Target Info

• Gene Symbol: CBLL2
• Gene Full Name: Cbl proto-oncogene like 2
• Alias Symbols: CT138, HAKAIL, ZNF645
• NCBI Gene Id: 158506
• Protein Name: E3 ubiquitin-protein ligase CBLL2
• Description of Target: This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control.
• Uniprot ID: Q8N7E2
• Protein Accession #: NP_689790
• Nucleotide Accession #: NM_152577
• Protein Size (# AA): 425
• Molecular Weight: 49kDa
• Protein Interactions: UBC;