SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61219_P050
Price: $0.00
SKU
ARP61219_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CARD17 Antibody - middle region (ARP61219_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for ARP61219_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CARD17
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP61219 (Previous Catalog # AAPP47366)
Gene SymbolCARD17
Gene Full NameCaspase recruitment domain family, member 17
Alias SymbolsINCA
NCBI Gene Id440068
Protein NameCaspase recruitment domain-containing protein 17
Description of TargetAs a regulator of procaspase-1/CASP1 activation, CARD17 is implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. CARD17 inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, CARD17 do not induce NF-kappa-B activation.
Uniprot IDQ5XLA6
Protein Accession #NP_001007233
Nucleotide Accession #NM_001007232
Protein Size (# AA)110
Molecular Weight12kDa
Protein InteractionsCARD17; CARD16; CARD18; CASP1;
  1. What is the species homology for "CARD17 Antibody - middle region (ARP61219_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CARD17 Antibody - middle region (ARP61219_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CARD17 Antibody - middle region (ARP61219_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CARD17 Antibody - middle region (ARP61219_P050)"?

    This target may also be called "INCA" in publications.

  5. What is the shipping cost for "CARD17 Antibody - middle region (ARP61219_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CARD17 Antibody - middle region (ARP61219_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CARD17 Antibody - middle region (ARP61219_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "12kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CARD17 Antibody - middle region (ARP61219_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CARD17"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CARD17"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CARD17"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CARD17"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CARD17"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CARD17"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CARD17 Antibody - middle region (ARP61219_P050)
Your Rating