Catalog No: ARP54435_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

C5orf39 Antibody - N-terminal region (ARP54435_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ANXA2R (ARP54435_P050) antibody
Product Info
ReferenceLu,G., (2006) J. Biol. Chem. 281 (41), 30542-30550
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C5orf39
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
Concentration0.5 mg/ml
Blocking PeptideFor anti-ANXA2R (ARP54435_P050) antibody is Catalog # AAP54435 (Previous Catalog # AAPP31215)
Gene SymbolANXA2R
Gene Full NameAnnexin A2 receptor
Alias SymbolsAX2R, AXIIR, C5orf39
NCBI Gene Id389289
Protein NameAnnexin-2 receptor
Description of TargetC5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
Uniprot IDQ3ZCQ2
Protein Accession #NP_001014301
Nucleotide Accession #NM_001014279
Protein Size (# AA)193
Molecular Weight22kDa
Protein InteractionsELAVL1;
  1. What is the species homology for "C5orf39 Antibody - N-terminal region (ARP54435_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "C5orf39 Antibody - N-terminal region (ARP54435_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C5orf39 Antibody - N-terminal region (ARP54435_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "C5orf39 Antibody - N-terminal region (ARP54435_P050)"?

    This target may also be called "AX2R, AXIIR, C5orf39" in publications.

  5. What is the shipping cost for "C5orf39 Antibody - N-terminal region (ARP54435_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C5orf39 Antibody - N-terminal region (ARP54435_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C5orf39 Antibody - N-terminal region (ARP54435_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C5orf39 Antibody - N-terminal region (ARP54435_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ANXA2R"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANXA2R"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANXA2R"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANXA2R"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANXA2R"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANXA2R"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C5orf39 Antibody - N-terminal region (ARP54435_P050)
Your Rating