BAS1 Recombinant Protein (Mouse-ear cress) (OPCA04505)

Catalog No: OPCA04505

Product Info

• Predicted Species Reactivity: Arabidopsis thaliana
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Arabidopsis thaliana (Mouse-ear cress)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
• Protein Sequence: KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 66-266 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana.Salanoubat M., Lemcke K., Rieger M., Ansorge W., Unseld M., Fartmann B., Valle G., Bloecker H., Perez-Alonso M., Obermaier B., Delseny M., Boutry M., Grivell L.A., Mache R., Puigdomenech P., De Simone V., Choisne N., Artiguenave F. Tabata S.Nature 408:820-822(2000)
• Gene Symbol: AT3G11630
• Gene Full Name: Thioredoxin superfamily protein
• Alias Symbols: AT3G11630;T19F11.3;Thiol-specific antioxidant protein A;Thioredoxin superfamily protein.
• NCBI Gene Id: 820335
• Protein Name: 2-Cys peroxiredoxin BAS1, chloroplastic
• Description of Target: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf.
• Uniprot ID: Q96291
• Protein Accession #: NP_187769
• Nucleotide Accession #: NM_111995
• Protein Size (# AA): Recombinant
• Molecular Weight: 24.4 kDa