BARD1 Antibody - C-terminal region (ARP42953_P050)

Catalog No: ARP42953_P050

Host: Rabbit
Target Name: BARD1
Sample Type: MCF7 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human BARD1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BARD1 (ARP42953_P050) antibody is Catalog # AAP42953

Target Info

• Gene Symbol: BARD1
• Gene Full Name: BRCA1 associated RING domain 1
• NCBI Gene Id: 580
• Protein Name: BRCA1-associated RING domain protein 1
• Description of Target: This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: F6MDH8
• Protein Accession #: NP_000456.2
• Nucleotide Accession #: NM_000465.3
• Protein Size (# AA): 680
• Molecular Weight: 74kDa