ARVCF Antibody - middle region (ARP84952_P050)

Catalog No: ARP84952_P050

Host: Rabbit
Target Name: ARVCF
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARVCF
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ARVCF (ARP84952_P050) antibody is Catalog # AAP84952

Target Info

• Gene Symbol: ARVCF
• Gene Full Name: armadillo repeat gene deleted in velocardiofacial syndrome
• NCBI Gene Id: 421
• Protein Name: armadillo repeat protein deleted in velo-cardio-facial syndrome
• Description of Target: Armadillo Repeat gene deleted in Velo-Cardio-Facial syndrome (ARVCF) is a member of the catenin family. This family plays an important role in the formation of adherens junction complexes, which are thought to facilitate communication between the inside and outside environments of a cell. The ARVCF gene was isolated in the search for the genetic defect responsible for the autosomal dominant Velo-Cardio-Facial syndrome (VCFS), a relatively common human disorder with phenotypic features including cleft palate, conotruncal heart defects and facial dysmorphology. The ARVCF gene encodes a protein containing two motifs, a coiled coil domain in the N-terminus and a 10 armadillo repeat sequence in the midregion. Since these sequences can facilitate protein-protein interactions ARVCF is thought to function in a protein complex. In addition, ARVCF contains a predicted nuclear-targeting sequence suggesting that it may have a function as a nuclear protein.
• Uniprot ID: O00192-2
• Protein Accession #: NP_001661.1
• Nucleotide Accession #: NM_001670.2
• Protein Size (# AA): 899
• Molecular Weight: 98 kDa