SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP89524_P050
Price: $0.00
SKU
ARP89524_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ARG2 (ARP89524_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse ARG2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: DAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPN
Concentration0.5 mg/ml
Blocking PeptideFor anti-ARG2 (ARP89524_P050) antibody is Catalog # AAP89524
Gene SymbolARG2
Gene Full Namearginase type II
Alias SymbolsAII, AU022422
NCBI Gene Id11847
Protein Namearginase-2, mitochondrial
Description of TargetMay play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to nitric oxid synthase (NOS). Arginine metabolism is a critical regulator of innate and adaptive immune responses. Seems to be involved in negative regulation of the survival capacity of activated CD4+ and CD8+ T cells. May suppress inflammation-related signaling in asthmatic airway epithelium. May contribute to the immune evasion of H.pylori by restricting M1 macrophage activation and polyamine metabolism. May play a role in promoting prenatal immune suppression (By similarity). Regulates RPS6KB1 signaling, which promotes endothelial cell senescence and inflammation and implicates NOS3/eNOS dysfunction. Can inhibit endothelial autophagy independently of its enzymatic activity implicating mTORC2 signaling. Involved in vascular smooth muscle cell senescence and apoptosis independently of its enzymatic activity (By similarity).
Uniprot IDO08691
Protein Accession #NP_033835.1
Nucleotide Accession #NM_009705.3
Protein Size (# AA)354
Molecular Weight38 kDa
  1. What is the species homology for "ARG2 Antibody - middle region (ARP89524_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "ARG2 Antibody - middle region (ARP89524_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "ARG2 Antibody - middle region (ARP89524_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARG2 Antibody - middle region (ARP89524_P050)"?

    This target may also be called "AII, AU022422" in publications.

  5. What is the shipping cost for "ARG2 Antibody - middle region (ARP89524_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARG2 Antibody - middle region (ARP89524_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARG2 Antibody - middle region (ARP89524_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARG2 Antibody - middle region (ARP89524_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ARG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARG2 Antibody - middle region (ARP89524_P050)
Your Rating