APPBP2 Antibody - middle region (ARP52171_P050)

Catalog No: ARP52171_P050

WB Suggested Anti-APPBP2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APPBP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-APPBP2 (ARP52171_P050) antibody is Catalog # AAP52171 (Previous Catalog # AAPP40394)
• Reference: Benboudjema,L., (2003) J. Virol. 77 (17), 9192-9203

Target Info

• Gene Symbol: APPBP2
• Gene Full Name: Amyloid beta precursor protein (cytoplasmic tail) binding protein 2
• Alias Symbols: PAT1, APP-BP2, HS.84084
• NCBI Gene Id: 10513
• Protein Name: Amyloid protein-binding protein 2
• Description of Target: APPBP2 interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. APPBP2 has been found to be highly expressed in breast cancer.The protein encoded by this gene interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. This gene has been found to be highly expressed in breast cancer. Multiple polyadenylation sites have been found for this gene.
• Uniprot ID: Q92624
• Protein Accession #: NP_006371
• Nucleotide Accession #: NM_006380
• Protein Size (# AA): 585
• Molecular Weight: 67kDa
• Protein Interactions: WDR24; RASSF5; RNF34; CTC1; LONRF3; RNF128; SLC25A23; C1orf50; ZNF747; ARMCX5; CCNL1; LANCL2; UGGT2; ANKRD10; UBE2R2; FXYD7; LUC7L2; LUZP4; AK3; ERO1L; ST8SIA5; SNX5; RRS1; TCF25; SYNRG; FSTL1; TBL3; CORO2B; DHRS2; AIM2; KLF11; HIST1H2AK; NPRL3; WAS; TAF1