ALDH18A1 Antibody - N-terminal region (ARP56216_P050)

Catalog No: ARP56216_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALDH18A1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ALDH18A1 (ARP56216_P050) antibody is Catalog # AAP56216 (Previous Catalog # AAPP38135)
• Sample Type Confirmation:

  ALDH18A1 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Baumgartner,M.R., (2005) Eur. J. Pediatr. 164 (1), 31-36

Target Info

• Gene Symbol: ALDH18A1
• Gene Full Name: Aldehyde dehydrogenase 18 family, member A1
• Alias Symbols: GSAS, P5CS, PYCS, SPG9, ADCL3, SPG9A, SPG9B, ARCL3A
• NCBI Gene Id: 5832
• Protein Name: Delta-1-pyrroline-5-carboxylate synthase
• Description of Target: This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases.This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases. Alternatively spliced transcript variants, encoding different isoforms, have been described for this gene.
• Uniprot ID: P54886
• Protein Accession #: NP_001017423
• Nucleotide Accession #: NM_001017423
• Protein Size (# AA): 793
• Molecular Weight: 87 kDa
• Protein Interactions: CMTM5; AGTRAP; UBC; SUMO2; SUMO3; STAU1; MDM2; LATS2; ADRB2; VCP; TIMM13; SUMO1; NONO; MTHFD1; ILF3; ILF2; DDX1; CUL3; CDK2; SIRT7; TCF3; Haus1; Mical3; Trim69; Cbx1; HDAC5; MYC; ICT1; ZRANB1;