AKAP5 Antibody - middle region (ARP36322_P050)

Catalog No: ARP36322_P050

WB Suggested Anti-AKAP5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKAP5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79%; Yeast: 82%
• Peptide Sequence: Synthetic peptide located within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AKAP5 (ARP36322_P050) antibody is Catalog # AAP36322 (Previous Catalog # AAPP07509)
• Reference: Lu,R. (2008) J. Biol. Chem. 283 (17), 11445-11452

Target Info

• Gene Symbol: AKAP5
• Gene Full Name: A kinase (PRKA) anchor protein 5
• Alias Symbols: H21, AKAP75, AKAP79
• NCBI Gene Id: 9495
• Protein Name: A-kinase anchor protein 5
• Description of Target: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP5 is a member of the AKAP family. It binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT.The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P24588
• Protein Accession #: NP_004848
• Nucleotide Accession #: NM_004857
• Protein Size (# AA): 427
• Molecular Weight: 47kDa
• Protein Interactions: PRKACB; PRKACA; UBC; PRKCA; CALM1; GABRB1; GABRB3; IQGAP1; DLG4; DLG1; KCNJ2; PRKAR2B; PRKAR2A; RET; PPP3CA; ADRB2; Gria1; Grin2b;