AK8 Antibody - C-terminal region (ARP53041_P050)

Catalog No: ARP53041_P050

Host: Rabbit
Target Name: AK8
Sample Type: Thyroid tumor lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AK8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 77%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: FDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AK8 (ARP53041_P050) antibody is Catalog # AAP53041

Target Info

• Gene Symbol: AK8
• Gene Full Name: adenylate kinase 8
• Alias Symbols: AK 8, DDX31, C9orf98
• NCBI Gene Id: 158067
• Protein Name: Adenylate kinase 8
• Description of Target: AK8 is a adenylate kinase. It has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP.
• Uniprot ID: Q96MA6-2
• Protein Accession #: NP_689785
• Nucleotide Accession #: NM_152572
• Protein Size (# AA): 275
• Molecular Weight: 30kDa
• Protein Interactions: ALKBH3; ZMAT2; HAUS1; CCDC102B; UBE2Z; MID1IP1; MAP3K7CL; RBM39; MCM7; PRMT6;