ADCY5 Antibody - middle region (ARP97700_P050)

Catalog No: ARP97700_P050

Host: Rabbit
Target Name: ADCY5
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADCY5
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADCY5 (ARP97700_P050) antibody is Catalog # AAP97700

Target Info

• Gene Symbol: ADCY5
• Gene Full Name: adenylate cyclase 5
• Alias Symbols: AC5, FDFM
• NCBI Gene Id: 111
• Protein Name: AC5, FDFM
• Description of Target: This gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha subunit of G protein-coupled receptors and is inhibited by protein kinase A, calcium and Gi alpha subunits. Single nucleotide polymorphisms in this gene may be associated with low birth weight and type 2 diabetes. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene.
• Uniprot ID: O95622
• Protein Accession #: NP_001186571.1
• Nucleotide Accession #: NM_001199642.1
• Protein Size (# AA): 1261
• Molecular Weight: 138 kDa