ACYP1 Antibody - middle region (ARP66998_P050)

Catalog No: ARP66998_P050

WB Suggested Anti-ACYP1 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACYP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP66998

Target Info

• Gene Symbol: ACYP1
• Alias Symbols: ACYPE
• NCBI Gene Id: 97
• Protein Name: Acylphosphatase-1
• Description of Target: Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis.
• Uniprot ID: P07311
• Protein Accession #: NP_001098
• Nucleotide Accession #: NM_001107
• Protein Size (# AA): 99
• Molecular Weight: 11kDa
• Protein Interactions: UBC; APP;