ACVR2B Antibody - C-terminal region : FITC (ARP75885_P050-FITC)

Catalog No: ARP75885_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AVR2B
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: DFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ACVR2B (ARP75885_P050-FITC) antibody is Catalog # AAP75885
• Reference: N/A

Target Info

• Gene Symbol: ACVR2B
• Gene Full Name: activin A receptor type 2B
• Alias Symbols: HTX4, ACTRIIB, ActR-IIB
• NCBI Gene Id: 93
• Protein Name: activin receptor type-2B
• Description of Target: Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
• Uniprot ID: Q13705
• Protein Accession #: NP_001097
• Protein Size (# AA): 512
• Molecular Weight: 56kDa